PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf01114g00015.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Dof
Protein Properties Length: 353aa    MW: 38253.4 Da    PI: 9.9099
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf01114g00015.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof120.17.9e-3870130363
                    zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63 
                               e+ +kcprC+stntkfCy+nnyslsqPr+fCk+CrryWt+GGalr vPvGgg+r+nk+sss
  Niben101Scf01114g00015.1  70 EAVQKCPRCESTNTKFCYFNNYSLSQPRHFCKTCRRYWTRGGALRSVPVGGGCRRNKRSSS 130
                               56789****************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074789.0E-3553127IPR003851Zinc finger, Dof-type
PfamPF027015.1E-3272127IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.99473127IPR003851Zinc finger, Dof-type
PROSITE patternPS01361075111IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 353 aa     Download sequence    Send to blast
MVFSSISAYL DPANWQQQAG HSIPNPQFQS VQPLRPLAPP PVQTHVGGGS TIRPGSMADR  60
ARLANIPMAE AVQKCPRCES TNTKFCYFNN YSLSQPRHFC KTCRRYWTRG GALRSVPVGG  120
GCRRNKRSSS STKATNNNNN TPKSPASSTS TGGGRQIPTN SGSTNNNNSF SSPSSAASLL  180
GLMSPQIHYP LRFMSPLGQL TDHHFTPNDN NITMNYSAIS SSSAPVTGTN ESMNFQLAMG  240
GNLEQWRLQQ QVANQFPNFY GGLDSSSASG LYPFYPAYYT SNDGVTVTSS QIRPKITNPM  300
LTQLALMKME DNHGHSSLSR QFVGNQGSEN WSNGNAWNEL SASFSSSPTS NAL
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00483DAPTransfer from AT5G02460Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009780702.10.0PREDICTED: dof zinc finger protein DOF2.4-like
RefseqXP_016473568.10.0PREDICTED: dof zinc finger protein DOF2.4-like
TrEMBLK4D4761e-129K4D476_SOLLC; Uncharacterized protein
STRINGSolyc10g086440.1.11e-129(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA19172463
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37590.12e-47DNA binding with one finger 2.4